Lineage for d1plza_ (1plz A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381160Superfamily b.82.1: RmlC-like cupins [51182] (12 families) (S)
  5. 381321Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein)
  6. 381322Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
    Type II phosphoglucose isomerase
  7. 381323Species Archaeon Pyrococcus furiosus [TaxId:2261] [89405] (4 PDB entries)
  8. 381330Domain d1plza_: 1plz A: [88160]
    complexed with mse; mutant

Details for d1plza_

PDB Entry: 1plz (more details), 2 Å

PDB Description: crystal structure of phosphoglucose isomerase from pyrococcus furiosus

SCOP Domain Sequences for d1plza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plza_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprw

SCOP Domain Coordinates for d1plza_:

Click to download the PDB-style file with coordinates for d1plza_.
(The format of our PDB-style files is described here.)

Timeline for d1plza_: