Lineage for d1pkqj_ (1pkq J:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 452432Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 452433Species Rat (Rattus norvegicus) [TaxId:10116] [89175] (3 PDB entries)
  8. 452437Domain d1pkqj_: 1pkq J: [88157]
    Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2

Details for d1pkqj_

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

SCOP Domain Sequences for d1pkqj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkqj_ b.1.1.1 (J:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus)}
gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae
qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp

SCOP Domain Coordinates for d1pkqj_:

Click to download the PDB-style file with coordinates for d1pkqj_.
(The format of our PDB-style files is described here.)

Timeline for d1pkqj_: