Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [89175] (3 PDB entries) |
Domain d1pkqj_: 1pkq J: [88157] Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2 |
PDB Entry: 1pkq (more details), 3 Å
SCOP Domain Sequences for d1pkqj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkqj_ b.1.1.1 (J:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus)} gqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqdae qapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
Timeline for d1pkqj_: