SCOPe 2.02: Domain d1pkqf2: 1pkq F:108-210

Lineage for d1pkqf2 (1pkq F:108-210)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1pkqf2: 1pkq F:108-210 [88154]
Other proteins in same PDB: d1pkqa1, d1pkqb1, d1pkqb2, d1pkqe_, d1pkqf1, d1pkqg1, d1pkqg2, d1pkqj_
part of humanized Fab 8-18c5

Details for d1pkqf2

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

PDB Compounds: (F:) (8-18C5) chimeric Fab, light chain

SCOPe Domain Sequences for d1pkqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkqf2 b.1.1.2 (F:108-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOPe Domain Coordinates for d1pkqf2:

Click to download the PDB-style file with coordinates for d1pkqf2.
(The format of our PDB-style files is described here.)

Timeline for d1pkqf2: