SCOPe 2.04: Domain d1pkqe_: 1pkq E:

Lineage for d1pkqe_ (1pkq E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89175] (4 PDB entries)

8. Domain d1pkqe_: 1pkq E: [88152]
   Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2

Details for d1pkqe_

PDB Entry: 1pkq, 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

PDB Compounds: (E:) Myelin Oligodendrocyte Glycoprotein

SCOPe Domain Sequences for d1pkqe_:

Sequence; same for both SEQRES and ATOM records:

>d1pkqe_ b.1.1.1 (E:) Myelin oligodendrocyte glycoprotein (MOG) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd
aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
f

Timeline for d1pkqe_:

• d1pkqe_ first appeared in SCOP 1.65
  
• d1pkqe_ appears in SCOPe 2.03
  
• d1pkqe_ appears in SCOPe 2.05
  
• d1pkqe_ appears in the current release, SCOPe 2.07, called d1pkqe1