Lineage for d1pkqe_ (1pkq E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653942Protein Myelin oligodendrocyte glycoprotein (MOG) [89174] (1 species)
  7. 653943Species Rat (Rattus norvegicus) [TaxId:10116] [89175] (3 PDB entries)
  8. 653946Domain d1pkqe_: 1pkq E: [88152]
    Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb1, d1pkqb2, d1pkqf1, d1pkqf2, d1pkqg1, d1pkqg2

Details for d1pkqe_

PDB Entry: 1pkq (more details), 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex
PDB Compounds: (E:) Myelin Oligodendrocyte Glycoprotein

SCOP Domain Sequences for d1pkqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkqe_ b.1.1.1 (E:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]}
gsgqfrvigpghpiralvgdeaelpcrispgknatgmevgwyrspfsrvvhlyrngkdqd
aeqapeyrgrtellkesigegkvalriqnvrfsdeggytcffrdhsyqeeaavelkvedp
f

SCOP Domain Coordinates for d1pkqe_:

Click to download the PDB-style file with coordinates for d1pkqe_.
(The format of our PDB-style files is described here.)

Timeline for d1pkqe_: