SCOP 1.73: Domain d1pkqb1: 1pkq B:1-113

Lineage for d1pkqb1 (1pkq B:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1pkqb1: 1pkq B:1-113 [88150]
   Other proteins in same PDB: d1pkqa1, d1pkqa2, d1pkqb2, d1pkqe_, d1pkqf1, d1pkqf2, d1pkqg2, d1pkqj_

Details for d1pkqb1

PDB Entry: 1pkq, 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

PDB Compounds: (B:) (8-18C5) chimeric Fab, heavy chain

SCOP Domain Sequences for d1pkqb1:

Sequence; same for both SEQRES and ATOM records:

>d1pkqb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evklhesgaglvkpgasveisckatgytfssfwiewvkqrpghglewigeilpgrgrtny
nekfkgkatftaetssntaymqlssltsedsavyycatgntmvnmpywgqgttvtvss

Timeline for d1pkqb1:

• d1pkqb1 first appeared in SCOP 1.65
  
• d1pkqb1 appears in SCOP 1.71
  
• d1pkqb1 appears in SCOP 1.75
  
• d1pkqb1 appears in the current release, SCOPe 2.08