SCOP 1.75: Domain d1pkqa1: 1pkq A:1-107

Lineage for d1pkqa1 (1pkq A:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)

8. Domain d1pkqa1: 1pkq A:1-107 [88148]
   Other proteins in same PDB: d1pkqa2, d1pkqb1, d1pkqb2, d1pkqe_, d1pkqf2, d1pkqg1, d1pkqg2, d1pkqj_
   part of humanized Fab 8-18c5

Details for d1pkqa1

PDB Entry: 1pkq, 3 Å

PDB Description: Myelin Oligodendrocyte Glycoprotein-(8-18C5) Fab-complex

PDB Compounds: (A:) (8-18C5) chimeric Fab, light chain

SCOP Domain Sequences for d1pkqa1:

Sequence; same for both SEQRES and ATOM records:

>d1pkqa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
dieltqspsslavsagekvtmsckssqsllnsgnqknylawyqqkpglppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleik

Timeline for d1pkqa1:

• d1pkqa1 first appeared in SCOP 1.65
  
• d1pkqa1 appears in SCOP 1.73
  
• d1pkqa1 appears in SCOPe 2.01
  
• d1pkqa1 appears in the current release, SCOPe 2.08