Lineage for d1pkdd2 (1pkd D:310-432)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283121Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 283122Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 283123Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 283128Protein Cyclin A [47956] (2 species)
  7. 283132Species Human (Homo sapiens) [TaxId:9606] [47957] (18 PDB entries)
  8. 283170Domain d1pkdd2: 1pkd D:310-432 [88146]
    Other proteins in same PDB: d1pkda_, d1pkdc_
    complexed with tpo, ucn

Details for d1pkdd2

PDB Entry: 1pkd (more details), 2.3 Å

PDB Description: the crystal structure of ucn-01 in complex with phospho-cdk2/cyclin a

SCOP Domain Sequences for d1pkdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkdd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1pkdd2:

Click to download the PDB-style file with coordinates for d1pkdd2.
(The format of our PDB-style files is described here.)

Timeline for d1pkdd2: