Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries) |
Domain d1pjlc1: 1pjl C:2280-2573 [88127] Other proteins in same PDB: d1pjla2, d1pjlb2, d1pjlc2, d1pjld2, d1pjle2, d1pjlf2, d1pjlg2, d1pjlh2 |
PDB Entry: 1pjl (more details), 2.9 Å
SCOP Domain Sequences for d1pjlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjlc1 c.2.1.7 (C:2280-2573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)} iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp
Timeline for d1pjlc1: