SCOP 1.65: Domain d1pjla2: 1pjl A:23-279

Lineage for d1pjla2 (1pjl A:23-279)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Mitochondrial NAD(P)-dependenent malic enzyme [53240] (1 protein)
   this domain is decorated with additional structures; includes N-terminal additional subdomains and exta N-terminal strand

6. Protein Mitochondrial NAD(P)-dependenent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (7 PDB entries)

8. Domain d1pjla2: 1pjl A:23-279 [88124]
   Other proteins in same PDB: d1pjla1, d1pjlb1, d1pjlc1, d1pjld1, d1pjle1, d1pjlf1, d1pjlg1, d1pjlh1

Details for d1pjla2

PDB Entry: 1pjl, 2.9 Å

PDB Description: crystal structure of human m-nad-me in ternary complex with nad and lu3+

SCOP Domain Sequences for d1pjla2:

Sequence; same for both SEQRES and ATOM records:

>d1pjla2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

Timeline for d1pjla2:

• d1pjla2 is new in SCOP 1.65
  
• d1pjla2 appears in SCOP 1.67
  
• d1pjla2 appears in the current release, SCOPe 2.08