Lineage for d1pj8a_ (1pj8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850577Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1850615Protein Proteinase K [52762] (1 species)
  7. 1850616Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (24 PDB entries)
    Uniprot P06873
  8. 1850635Domain d1pj8a_: 1pj8 A: [88121]
    complexed with hg

Details for d1pj8a_

PDB Entry: 1pj8 (more details), 2.2 Å

PDB Description: structure of a ternary complex of proteinase k, mercury and a substrate-analogue hexapeptide at 2.2 a resolution
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d1pj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj8a_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d1pj8a_:

Click to download the PDB-style file with coordinates for d1pj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1pj8a_: