SCOPe 2.06: Domain d1piub_: 1piu B:

Lineage for d1piub_ (1piu B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d1piub_: 1piu B: [88120]
   complexed with fe, hg, o; mutant

Details for d1piub_

PDB Entry: 1piu, 2.2 Å

PDB Description: oxidized ribonucleotide reductase r2-d84e mutant containing oxo- bridged diferric cluster

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1piub_:

Sequence; same for both SEQRES and ATOM records:

>d1piub_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

Timeline for d1piub_:

• d1piub_ first appeared in SCOP 1.65
  
• d1piub_ appears in SCOPe 2.05
  
• d1piub_ appears in SCOPe 2.07
  
• d1piub_ appears in the current release, SCOPe 2.08