Lineage for d1pi6a1 (1pi6 A:2-326)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418400Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2418401Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 2418402Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries)
  8. 2418407Domain d1pi6a1: 1pi6 A:2-326 [88115]
    complexed with zn

Details for d1pi6a1

PDB Entry: 1pi6 (more details), 2.5 Å

PDB Description: yeast actin interacting protein 1 (aip1), orthorhombic crystal form
PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1pi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pi6a1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
vgvvatgngriislsldgtlnfyel

SCOPe Domain Coordinates for d1pi6a1:

Click to download the PDB-style file with coordinates for d1pi6a1.
(The format of our PDB-style files is described here.)

Timeline for d1pi6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pi6a2