![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
![]() | Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries) |
![]() | Domain d1phja2: 1phj A:205-328 [88112] Other proteins in same PDB: d1phjb_ protein/DNA complex |
PDB Entry: 1phj (more details), 2.5 Å
SCOPe Domain Sequences for d1phja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phja2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]} vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl kknv
Timeline for d1phja2: