SCOP 1.65: Domain d1ph9a2: 1ph9 A:205-328

Lineage for d1ph9a2 (1ph9 A:205-328)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (9 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1ph9a2: 1ph9 A:205-328 [88108]
   Other proteins in same PDB: d1ph9b_

Details for d1ph9a2

PDB Entry: 1ph9, 2.5 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgagg

SCOP Domain Sequences for d1ph9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ph9a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

Timeline for d1ph9a2:

• d1ph9a2 is new in SCOP 1.65
  
• d1ph9a2 appears in SCOP 1.67
  
• d1ph9a2 appears in the current release, SCOPe 2.08