![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
![]() | Species Oxytricha nova [TaxId:200597] [50276] (13 PDB entries) |
![]() | Domain d1ph7b_: 1ph7 B: [88102] Other proteins in same PDB: d1ph7a1, d1ph7a2, d1ph7a3 complexed with cl, na; mutant |
PDB Entry: 1ph7 (more details), 2.9 Å
SCOP Domain Sequences for d1ph7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ph7b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova} qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag ivkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d1ph7b_: