Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries) |
Domain d1ph5b_: 1ph5 B: [88094] Other proteins in same PDB: d1ph5a1, d1ph5a2, d1ph5a3 protein/DNA complex; complexed with cl, na |
PDB Entry: 1ph5 (more details), 2.3 Å
SCOPe Domain Sequences for d1ph5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ph5b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]} qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag ivkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d1ph5b_: