SCOP 1.65: Domain d1ph5a3: 1ph5 A:329-494

Lineage for d1ph5a3 (1ph5 A:329-494)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (9 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1ph5a3: 1ph5 A:329-494 [88093]
   Other proteins in same PDB: d1ph5b_
   complexed with 3dr, cl, na; mutant

Details for d1ph5a3

PDB Entry: 1ph5, 2.3 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttg(3dr)gg

SCOP Domain Sequences for d1ph5a3:

Sequence; same for both SEQRES and ATOM records:

>d1ph5a3 b.40.4.3 (A:329-494) Telomere end binding protein alpha subunit {Oxytricha nova}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkli

Timeline for d1ph5a3:

• d1ph5a3 is new in SCOP 1.65
  
• d1ph5a3 appears in SCOP 1.67
  
• d1ph5a3 appears in the current release, SCOPe 2.07