![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
![]() | Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries) |
![]() | Domain d1ph3b_: 1ph3 B: [88086] Other proteins in same PDB: d1ph3a1, d1ph3a2, d1ph3a3 protein/DNA complex; complexed with na |
PDB Entry: 1ph3 (more details), 2.3 Å
SCOPe Domain Sequences for d1ph3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ph3b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]} qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag ivkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d1ph3b_: