SCOPe 2.01: Domain d1ph3a2: 1ph3 A:205-328

Lineage for d1ph3a2 (1ph3 A:205-328)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)

8. Domain d1ph3a2: 1ph3 A:205-328 [88084]
   Other proteins in same PDB: d1ph3b_
   protein/DNA complex; complexed with na

Details for d1ph3a2

PDB Entry: 1ph3, 2.3 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggtg

PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d1ph3a2:

Sequence; same for both SEQRES and ATOM records:

>d1ph3a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

Timeline for d1ph3a2:

• d1ph3a2 first appeared in SCOP 1.65
  
• d1ph3a2 appears in SCOP 1.75
  
• d1ph3a2 appears in SCOPe 2.02
  
• d1ph3a2 appears in the current release, SCOPe 2.08