SCOP 1.67: Domain d1ph2a2: 1ph2 A:205-328

Lineage for d1ph2a2 (1ph2 A:205-328)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1ph2a2: 1ph2 A:205-328 [88080]
   Other proteins in same PDB: d1ph2b_

Details for d1ph2a2

PDB Entry: 1ph2, 3.1 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttg

SCOP Domain Sequences for d1ph2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ph2a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

Timeline for d1ph2a2:

• d1ph2a2 first appeared in SCOP 1.65
  
• d1ph2a2 appears in SCOP 1.69
  
• d1ph2a2 appears in the current release, SCOPe 2.08