SCOPe 2.01: Domain d1ph1b_: 1ph1 B:

Lineage for d1ph1b_ (1ph1 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)

7. Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)

8. Domain d1ph1b_: 1ph1 B: [88078]
   Other proteins in same PDB: d1ph1a1, d1ph1a2, d1ph1a3
   protein/DNA complex

Details for d1ph1b_

PDB Entry: 1ph1, 2.51 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggggt

PDB Compounds: (B:) Telomere-binding protein beta subunit

SCOPe Domain Sequences for d1ph1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ph1b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
pqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkea
vnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqe
rlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvda
givkasaskgdefsdfsfkegntatlkiadifvqekg

Timeline for d1ph1b_:

• d1ph1b_ first appeared in SCOP 1.65
  
• d1ph1b_ appears in SCOP 1.75
  
• d1ph1b_ appears in SCOPe 2.02
  
• d1ph1b_ appears in the current release, SCOPe 2.08