SCOP 1.67: Domain d1ph1a3: 1ph1 A:329-495

Lineage for d1ph1a3 (1ph1 A:329-495)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1ph1a3: 1ph1 A:329-495 [88077]
   Other proteins in same PDB: d1ph1b_

Details for d1ph1a3

PDB Entry: 1ph1, 2.51 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttggggt

SCOP Domain Sequences for d1ph1a3:

Sequence; same for both SEQRES and ATOM records:

>d1ph1a3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

Timeline for d1ph1a3:

• d1ph1a3 first appeared in SCOP 1.65
  
• d1ph1a3 appears in SCOP 1.69
  
• d1ph1a3 appears in the current release, SCOPe 2.07