Lineage for d1pgva_ (1pgv A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310356Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 310357Superfamily c.10.1: RNI-like [52047] (3 families) (S)
    regular structure consisting of similar repeats
  5. 310358Family c.10.1.1: 28-residue LRR [52048] (2 proteins)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 310366Protein Tropomodulin C-terminal domain [82322] (2 species)
    duplication: consists of 5 repeats
  7. 310369Species nematode (Caenorhabditis elegans) [TaxId:6239] [89566] (1 PDB entry)
  8. 310370Domain d1pgva_: 1pgv A: [88073]
    structural genomics

Details for d1pgva_

PDB Entry: 1pgv (more details), 1.8 Å

PDB Description: structural genomics of caenorhabditis elegans: tropomodulin c-terminal domain

SCOP Domain Sequences for d1pgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans)}
tdvescinrlreddtdlkevninnmkrvskerirslieaacnskhiekfslantaisdse
arglielietspslrvlnvesnfltpellarllrstlvtqsivefkadnqrqsvlgnqve
mdmmmaieenesllrvgisfasmearhrvsealernyervrlrrlgk

SCOP Domain Coordinates for d1pgva_:

Click to download the PDB-style file with coordinates for d1pgva_.
(The format of our PDB-style files is described here.)

Timeline for d1pgva_: