Class b: All beta proteins [48724] (126 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40-repeat [50978] (1 family) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (7 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Actin interacting protein 1 [89378] (2 species) 14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries) |
Domain d1pgub2: 1pgu B:327-615 [88072] complexed with mse, zn; mutant |
PDB Entry: 1pgu (more details), 2.3 Å
SCOP Domain Sequences for d1pgub2:
Sequence, based on SEQRES records: (download)
>d1pgub2 b.69.4.1 (B:327-615) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae)} ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag dvmgkillydlqsrevktsrwafrtskinaiswkpaekganeeeieedlvatgsldtnif iysvkrpmkiikalnahkdgvnnllwetpstlvssgadacikrwnvvle
>d1pgub2 b.69.4.1 (B:327-615) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae)} ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag dvmgkillydlqsrevktsrwafrtskinaiswkpaeeieedlvatgsldtnifiysvkr pmkiikalnahkdgvnnllwetpstlvssgadacikrwnvvle
Timeline for d1pgub2: