Lineage for d1pgub2 (1pgu B:327-615)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2065973Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 2065974Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries)
  8. 2065978Domain d1pgub2: 1pgu B:327-615 [88072]
    complexed with zn

Details for d1pgub2

PDB Entry: 1pgu (more details), 2.3 Å

PDB Description: yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
PDB Compounds: (B:) Actin interacting protein 1

SCOPe Domain Sequences for d1pgub2:

Sequence, based on SEQRES records: (download)

>d1pgub2 b.69.4.1 (B:327-615) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey
ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln
spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag
dvmgkillydlqsrevktsrwafrtskinaiswkpaekganeeeieedlvatgsldtnif
iysvkrpmkiikalnahkdgvnnllwetpstlvssgadacikrwnvvle

Sequence, based on observed residues (ATOM records): (download)

>d1pgub2 b.69.4.1 (B:327-615) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ghdevlktisghnkgitaltvnplisgsydgrimewssssmhqdhsnlivsldnskaqey
ssiswddtlkvngitkhefgsqpkvasanndgftavltndddllilqsftgdiiksvrln
spgsavslsqnyvavgleegntiqvfklsdlevsfdlktplrakpsyisispsetyiaag
dvmgkillydlqsrevktsrwafrtskinaiswkpaeeieedlvatgsldtnifiysvkr
pmkiikalnahkdgvnnllwetpstlvssgadacikrwnvvle

SCOPe Domain Coordinates for d1pgub2:

Click to download the PDB-style file with coordinates for d1pgub2.
(The format of our PDB-style files is described here.)

Timeline for d1pgub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgub1