Lineage for d1pgub1 (1pgu B:2-326)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075801Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 2075802Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries)
  8. 2075805Domain d1pgub1: 1pgu B:2-326 [88071]
    complexed with zn

Details for d1pgub1

PDB Entry: 1pgu (more details), 2.3 Å

PDB Description: yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form
PDB Compounds: (B:) Actin interacting protein 1

SCOPe Domain Sequences for d1pgub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgub1 b.69.4.1 (B:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
vgvvatgngriislsldgtlnfyel

SCOPe Domain Coordinates for d1pgub1:

Click to download the PDB-style file with coordinates for d1pgub1.
(The format of our PDB-style files is described here.)

Timeline for d1pgub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgub2