SCOPe 2.05: Domain d1pgua1: 1pgu A:2-326

Lineage for d1pgua1 (1pgu A:2-326)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (12 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein Actin interacting protein 1 [89378] (2 species)
   14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89380] (2 PDB entries)

8. Domain d1pgua1: 1pgu A:2-326 [88069]
   complexed with zn

Details for d1pgua1

PDB Entry: 1pgu, 2.3 Å

PDB Description: yeast actin interacting protein 1 (aip1), se-met protein, monoclinic crystal form

PDB Compounds: (A:) Actin interacting protein 1

SCOPe Domain Sequences for d1pgua1:

Sequence; same for both SEQRES and ATOM records:

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgdskvppvvqftg
hgssvvttvkfspikgsqylcsgdesgkvivwgwtfdkesnsvevnvksefqvlagpisd
iswdfegrrlcvvgegrdnfgvfiswdsgnslgevsghsqrinachlkqsrpmrsmtvgd
dgsvvfyqgppfkfsasdrthhkqgsfvrdvefspdsgefvitvgsdrkiscfdgksgef
lkyieddqepvqggifalswldsqkfatvgadatirvwdvttskcvqkwtldkqqlgnqq
vgvvatgngriislsldgtlnfyel

Timeline for d1pgua1:

• d1pgua1 first appeared in SCOP 1.65
  
• d1pgua1 appears in SCOPe 2.04
  
• d1pgua1 appears in SCOPe 2.06
  
• d1pgua1 appears in the current release, SCOPe 2.08