SCOP 1.65: Domain d1pf4b1: 1pf4 B:321-564

Lineage for d1pf4b1 (1pf4 B:321-564)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (1 species)
   a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1)

7. Species Vibrio cholerae [TaxId:666] [89686] (1 PDB entry)

8. Domain d1pf4b1: 1pf4 B:321-564 [88054]
   Other proteins in same PDB: d1pf4a2, d1pf4b2, d1pf4c2, d1pf4d2

Details for d1pf4b1

PDB Entry: 1pf4, 3.8 Å

PDB Description: Structure of MsbA from Vibrio cholera: A Multidrug Resistance ABC Transporter Homolog in a Closed Conformation

SCOP Domain Sequences for d1pf4b1:

Sequence; same for both SEQRES and ATOM records:

>d1pf4b1 c.37.1.12 (B:321-564) Multidrug resistance ABC transporter MsbA, C-terminal domain {Vibrio cholerae}
lmdleterdngkyeaervngevdvkdvtftyqgkekpalshvsfsipqgktvalvgrsgs
gkstianlftrfydvdsgsicldghdvrdykltnlrrhfalvsqnvhlfndtianniaya
aegeytreqieqaarqahamefienmpqgldtvigengtslsggqrqrvaiarallrdap
vlildeatsaldteseraiqaaldelqknktvlviahrlstieqadeilvvdegeiierg
rhad

Timeline for d1pf4b1:

• d1pf4b1 is new in SCOP 1.65
  
• d1pf4b1 appears in SCOP 1.67
  
• d1pf4b1 last appears in SCOP 1.75