| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (14 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Multidrug resistance ABC transporter MsbA, C-terminal domain [89685] (1 species) a low-resolution structure of the E.coli MsbA in an open conformation is also available (f.35.1.1) |
| Species Vibrio cholerae [TaxId:666] [89686] (1 PDB entry) |
| Domain d1pf4b1: 1pf4 B:321-564 [88054] Other proteins in same PDB: d1pf4a2, d1pf4b2, d1pf4c2, d1pf4d2 |
PDB Entry: 1pf4 (more details), 3.8 Å
SCOP Domain Sequences for d1pf4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pf4b1 c.37.1.12 (B:321-564) Multidrug resistance ABC transporter MsbA, C-terminal domain {Vibrio cholerae}
lmdleterdngkyeaervngevdvkdvtftyqgkekpalshvsfsipqgktvalvgrsgs
gkstianlftrfydvdsgsicldghdvrdykltnlrrhfalvsqnvhlfndtianniaya
aegeytreqieqaarqahamefienmpqgldtvigengtslsggqrqrvaiarallrdap
vlildeatsaldteseraiqaaldelqknktvlviahrlstieqadeilvvdegeiierg
rhad
Timeline for d1pf4b1: