Lineage for d1peva1 (1pev A:2-312)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379749Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 379810Superfamily b.69.4: WD40-repeat [50978] (1 family) (S)
    also contains 8-bladed propellers
  5. 379811Family b.69.4.1: WD40-repeat [50979] (7 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 379812Protein Actin interacting protein 1 [89378] (2 species)
    14 repeats are arranged into two seven-bladed beta-propeller domains swapped with the N-terminal strands
  7. 379820Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89379] (2 PDB entries)
  8. 379823Domain d1peva1: 1pev A:2-312 [88047]

Details for d1peva1

PDB Entry: 1pev (more details), 2 Å

PDB Description: crystal structure of the actin interacting protein from caenorhabditis elegans

SCOP Domain Sequences for d1peva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peva1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans)}
sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
angfinfvnpe

SCOP Domain Coordinates for d1peva1:

Click to download the PDB-style file with coordinates for d1peva1.
(The format of our PDB-style files is described here.)

Timeline for d1peva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1peva2