SCOPe 2.07: Domain d1pe0a_: 1pe0 A:

Lineage for d1pe0a_ (1pe0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (62 PDB entries)
   Uniprot Q99497

8. Domain d1pe0a_: 1pe0 A: [88045]
   mutant

Details for d1pe0a_

PDB Entry: 1pe0, 1.7 Å

PDB Description: crystal structure of the k130r mutant of human dj-1

PDB Compounds: (A:) dj-1

SCOPe Domain Sequences for d1pe0a_:

Sequence; same for both SEQRES and ATOM records:

>d1pe0a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplardkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d1pe0a_:

• d1pe0a_ first appeared in SCOP 1.65
  
• d1pe0a_ appears in SCOPe 2.06
  
• d1pe0a_ appears in the current release, SCOPe 2.08