Lineage for d1pdwh_ (1pdw H:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117924Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2117925Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 2117926Species Human (Homo sapiens) [TaxId:9606] [89604] (45 PDB entries)
    Uniprot Q99497
  8. 2117982Domain d1pdwh_: 1pdw H: [88044]
    Other proteins in same PDB: d1pdwe2, d1pdwg2

Details for d1pdwh_

PDB Entry: 1pdw (more details), 2.2 Å

PDB Description: Crystal structure of human DJ-1, P 1 21 1 space group
PDB Compounds: (H:) dj-1

SCOPe Domain Sequences for d1pdwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdwh_ c.23.16.2 (H:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d1pdwh_:

Click to download the PDB-style file with coordinates for d1pdwh_.
(The format of our PDB-style files is described here.)

Timeline for d1pdwh_: