| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (6 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein DJ-1 [89603] (1 species) RNA-binding protein regulatory subunit |
| Species Human (Homo sapiens) [TaxId:9606] [89604] (8 PDB entries) |
| Domain d1pdwd_: 1pdw D: [88040] |
PDB Entry: 1pdw (more details), 2.2 Å
SCOP Domain Sequences for d1pdwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdwd_ c.23.16.2 (D:) DJ-1 {Human (Homo sapiens)}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk
Timeline for d1pdwd_: