SCOPe 2.06: Domain d1pbqa_: 1pbq A:

Lineage for d1pbqa_ (1pbq A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (27 PDB entries)

8. Domain d1pbqa_: 1pbq A: [88028]
   complexed with dk1

Details for d1pbqa_

PDB Entry: 1pbq, 1.9 Å

PDB Description: crystal structure of the nr1 ligand binding core in complex with 5,7- dichlorokynurenic acid (dcka) at 1.90 angstroms resolution

PDB Compounds: (A:) N-methyl-D-aspartate Receptor Subunit 1

SCOPe Domain Sequences for d1pbqa_:

Sequence, based on SEQRES records:

>d1pbqa_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqec

Sequence, based on observed residues (ATOM records):

>d1pbqa_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgvpqccygfcidlliklar
tmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivapltinneraqyie
fskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyr
hmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelffrsgfgigmrk
dspwkqnvslsilkshengfmedldktwvryqec

Timeline for d1pbqa_:

• d1pbqa_ first appeared in SCOP 1.65
  
• d1pbqa_ appears in SCOPe 2.05
  
• d1pbqa_ appears in SCOPe 2.07
  
• d1pbqa_ appears in the current release, SCOPe 2.08