Lineage for d1pb6d1 (1pb6 D:14-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761504Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 761519Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 761520Species Escherichia coli [TaxId:562] [88974] (1 PDB entry)
  8. 761524Domain d1pb6d1: 1pb6 D:14-85 [88023]
    Other proteins in same PDB: d1pb6a2, d1pb6b2, d1pb6c2, d1pb6d2

Details for d1pb6d1

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC
PDB Compounds: (D:) Hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6d1 a.4.1.9 (D:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre

SCOP Domain Coordinates for d1pb6d1:

Click to download the PDB-style file with coordinates for d1pb6d1.
(The format of our PDB-style files is described here.)

Timeline for d1pb6d1: