![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (19 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
![]() | Protein Hypothetical transcriptional regulator YcdC [88973] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [88974] (1 PDB entry) |
![]() | Domain d1pb6c1: 1pb6 C:14-85 [88021] Other proteins in same PDB: d1pb6a2, d1pb6b2, d1pb6c2, d1pb6d2 |
PDB Entry: 1pb6 (more details), 2.5 Å
SCOP Domain Sequences for d1pb6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pb6c1 a.4.1.9 (C:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil diwlaplkafre
Timeline for d1pb6c1: