SCOP 1.73: Domain d1pb6c1: 1pb6 C:14-85

Lineage for d1pb6c1 (1pb6 C:14-85)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)

7. Species Escherichia coli [TaxId:562] [88974] (1 PDB entry)

8. Domain d1pb6c1: 1pb6 C:14-85 [88021]
   Other proteins in same PDB: d1pb6a2, d1pb6b2, d1pb6c2, d1pb6d2

Details for d1pb6c1

PDB Entry: 1pb6, 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC

PDB Compounds: (C:) Hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6c1:

Sequence; same for both SEQRES and ATOM records:

>d1pb6c1 a.4.1.9 (C:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre

Timeline for d1pb6c1:

• d1pb6c1 first appeared in SCOP 1.65
  
• d1pb6c1 appears in SCOP 1.71
  
• d1pb6c1 last appears in SCOP 1.75