SCOP 1.65: Domain d1pb6b2: 1pb6 B:86-211

Lineage for d1pb6b2 (1pb6 B:86-211)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (3 proteins)

6. Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)

7. Species Escherichia coli [TaxId:562] [89137] (1 PDB entry)

8. Domain d1pb6b2: 1pb6 B:86-211 [88020]
   Other proteins in same PDB: d1pb6a1, d1pb6b1, d1pb6c1, d1pb6d1

Details for d1pb6b2

PDB Entry: 1pb6, 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6b2:

Sequence; same for both SEQRES and ATOM records:

>d1pb6b2 a.121.1.1 (B:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

Timeline for d1pb6b2:

• d1pb6b2 is new in SCOP 1.65
  
• d1pb6b2 appears in SCOP 1.67
  
• d1pb6b2 last appears in SCOP 1.75