Lineage for d1pb6a2 (1pb6 A:86-211)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)
  6. 647694Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 647695Species Escherichia coli [TaxId:562] [89137] (1 PDB entry)
  8. 647696Domain d1pb6a2: 1pb6 A:86-211 [88018]
    Other proteins in same PDB: d1pb6a1, d1pb6b1, d1pb6c1, d1pb6d1

Details for d1pb6a2

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC
PDB Compounds: (A:) Hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6a2 a.121.1.1 (A:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOP Domain Coordinates for d1pb6a2:

Click to download the PDB-style file with coordinates for d1pb6a2.
(The format of our PDB-style files is described here.)

Timeline for d1pb6a2: