Lineage for d1pb6a2 (1pb6 A:86-211)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360259Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 360260Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 360261Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (5 proteins)
  6. 360262Protein Hypothetical transcriptional regulator YcdC [89136] (1 species)
  7. 360263Species Escherichia coli [TaxId:562] [89137] (1 PDB entry)
  8. 360264Domain d1pb6a2: 1pb6 A:86-211 [88018]
    Other proteins in same PDB: d1pb6a1, d1pb6b1, d1pb6c1, d1pb6d1

Details for d1pb6a2

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC

SCOP Domain Sequences for d1pb6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6a2 a.121.1.1 (A:86-211) Hypothetical transcriptional regulator YcdC {Escherichia coli}
dfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlkalideksalia
gwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnqtvenvqriii
egirpr

SCOP Domain Coordinates for d1pb6a2:

Click to download the PDB-style file with coordinates for d1pb6a2.
(The format of our PDB-style files is described here.)

Timeline for d1pb6a2: