Lineage for d1pb5a_ (1pb5 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589395Fold g.65: Notch domain [90192] (1 superfamily)
    disulfide-rich; all-alpha; calcium-binding
  4. 2589396Superfamily g.65.1: Notch domain [90193] (1 family) (S)
    automatically mapped to Pfam PF00066
  5. 2589397Family g.65.1.1: Notch domain [90194] (1 protein)
    also called DSL domain or LNR repeat
  6. 2589398Protein Neurogenic locus notch homolog protein 1 [90195] (1 species)
  7. 2589399Species Human (Homo sapiens) [TaxId:9606] [90196] (1 PDB entry)
  8. 2589400Domain d1pb5a_: 1pb5 A: [88016]
    complexed with ca

Details for d1pb5a_

PDB Entry: 1pb5 (more details)

PDB Description: NMR Structure of a Prototype LNR Module from Human Notch1
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d1pb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb5a_ g.65.1.1 (A:) Neurogenic locus notch homolog protein 1 {Human (Homo sapiens) [TaxId: 9606]}
eeacelpecqedagnkvcslqcnnhacgwdggdcs

SCOPe Domain Coordinates for d1pb5a_:

Click to download the PDB-style file with coordinates for d1pb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pb5a_: