![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
![]() | Protein Isocitrate dehydrogenase, ICDH [53668] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53669] (26 PDB entries) |
![]() | Domain d1pb1a_: 1pb1 A: [88014] complexed with gol, ict, so4 |
PDB Entry: 1pb1 (more details), 1.7 Å
SCOPe Domain Sequences for d1pb1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm
Timeline for d1pb1a_: