Lineage for d1pb1a_ (1pb1 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493010Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 493011Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 493012Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 493054Protein Isocitrate dehydrogenase, ICDH [53668] (2 species)
  7. 493058Species Escherichia coli [TaxId:562] [53669] (26 PDB entries)
  8. 493059Domain d1pb1a_: 1pb1 A: [88014]

Details for d1pb1a_

PDB Entry: 1pb1 (more details), 1.7 Å

PDB Description: a four location model to explain the stereospecificity of proteins.

SCOP Domain Sequences for d1pb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli}
meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOP Domain Coordinates for d1pb1a_:

Click to download the PDB-style file with coordinates for d1pb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1pb1a_: