Lineage for d1pava_ (1pav A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330297Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 330337Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 330338Family d.68.3.3: SirA-like [88852] (4 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 330339Protein Hypothetical protein Ta1170/Ta1414 [89971] (1 species)
  7. 330340Species Archaeon Thermoplasma acidophilum [TaxId:2303] [89972] (1 PDB entry)
  8. 330341Domain d1pava_: 1pav A: [88013]
    structural genomics

Details for d1pava_

PDB Entry: 1pav (more details)

PDB Description: solution nmr structure of hypothetical protein ta1414 of thermoplasma acidophilum

SCOP Domain Sequences for d1pava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pava_ d.68.3.3 (A:) Hypothetical protein Ta1170/Ta1414 {Archaeon Thermoplasma acidophilum}
mdvkpdrvidargsycpgplmelikaykqakvgevisvystdagtkkdapawiqksgqel
vgvfdrngyyeivmkkvk

SCOP Domain Coordinates for d1pava_:

Click to download the PDB-style file with coordinates for d1pava_.
(The format of our PDB-style files is described here.)

Timeline for d1pava_: