Lineage for d1pa6b_ (1pa6 B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124702Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1124711Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 1124712Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)
  8. 1124721Domain d1pa6b_: 1pa6 B: [88012]
    Other proteins in same PDB: d1pa6a1, d1pa6a2, d1pa6a3
    protein/DNA complex; complexed with cl, na

Details for d1pa6b_

PDB Entry: 1pa6 (more details), 2.45 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgagg
PDB Compounds: (B:) Telomere-binding protein beta subunit

SCOPe Domain Sequences for d1pa6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa6b_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
ivkasaskgdefsdfsfkegntatlkiadifvqekg

SCOPe Domain Coordinates for d1pa6b_:

Click to download the PDB-style file with coordinates for d1pa6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pa6b_: