Lineage for d1pa6a2 (1pa6 A:205-328)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668213Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 668214Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 668237Domain d1pa6a2: 1pa6 A:205-328 [88010]
    Other proteins in same PDB: d1pa6b_

Details for d1pa6a2

PDB Entry: 1pa6 (more details), 2.45 Å

PDB Description: crystal structure of the oxytricha nova telomere end-binding protein complexed with noncognate ssdna ggggttttgagg
PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOP Domain Sequences for d1pa6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa6a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

SCOP Domain Coordinates for d1pa6a2:

Click to download the PDB-style file with coordinates for d1pa6a2.
(The format of our PDB-style files is described here.)

Timeline for d1pa6a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pa6b_