Lineage for d1p9uf_ (1p9u F:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 299664Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 299682Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
    contains an extra alpha-helical domain
  7. 299689Species Transmissible gastroenteritis virus [TaxId:11149] [74980] (2 PDB entries)
  8. 299701Domain d1p9uf_: 1p9u F: [88006]
    complexed with ch2, mpd, so4

Details for d1p9uf_

PDB Entry: 1p9u (more details), 2.37 Å

PDB Description: coronavirus main proteinase (3clpro) structure: basis for design of anti-sars drugs

SCOP Domain Sequences for d1p9uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9uf_ b.47.1.4 (F:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus}
sglrkmaqpsglvepcivrvsygnnvlnglwlgdevicprhviasdttrvinyenemssv
rlhnfsvsknnvflgvvsarykgvnlvlkvnqvnpntpehkfksikagesfnilacyegc
pgsvygvnmrsqgtikgsfiagtcgsvgyvlengilyfvymhhlelgngshvgsnfegem
yggyedqpsmqlegtnvmssdnvvaflyaalingerwfvtntsmslesyntwaktnsfte
lsstdafsmlaaktgqsveklldsivrlnkgfggrtilsygslcdeftptevirqmygvn

SCOP Domain Coordinates for d1p9uf_:

Click to download the PDB-style file with coordinates for d1p9uf_.
(The format of our PDB-style files is described here.)

Timeline for d1p9uf_: