Lineage for d1p9mc1 (1p9m C:96-195)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 551020Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)
  7. 551021Species Human (Homo sapiens) [TaxId:9606] [81978] (2 PDB entries)
  8. 551024Domain d1p9mc1: 1p9m C:96-195 [87995]
    Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mb_

Details for d1p9mc1

PDB Entry: 1p9m (more details), 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex
PDB Compounds: (C:)

SCOP Domain Sequences for d1p9mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9mc1 b.1.2.1 (C:96-195) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens)}
eepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkf
scqlavpegdssfyivsmcvassvgskfsktqtfqgcgil

SCOP Domain Coordinates for d1p9mc1:

Click to download the PDB-style file with coordinates for d1p9mc1.
(The format of our PDB-style files is described here.)

Timeline for d1p9mc1: