Lineage for d1p9mb_ (1p9m B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354365Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 354366Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 354367Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 354407Protein Interleukin-6 [47272] (2 species)
  7. 354408Species Human (Homo sapiens) [TaxId:9606] [47273] (4 PDB entries)
  8. 354410Domain d1p9mb_: 1p9m B: [87994]
    Other proteins in same PDB: d1p9ma1, d1p9ma2, d1p9ma3, d1p9mc1, d1p9mc2

Details for d1p9mb_

PDB Entry: 1p9m (more details), 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

SCOP Domain Sequences for d1p9mb_:

Sequence, based on SEQRES records: (download)

>d1p9mb_ a.26.1.1 (B:) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d1p9mb_ a.26.1.1 (B:) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnkcesskealaennlnlpkmaekdgcfqsgfnee
tclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdp
ttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOP Domain Coordinates for d1p9mb_:

Click to download the PDB-style file with coordinates for d1p9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1p9mb_: