Lineage for d1p9ma3 (1p9m A:197-299)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 454997Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 454998Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 455012Domain d1p9ma3: 1p9m A:197-299 [87993]
    Other proteins in same PDB: d1p9mb_, d1p9mc1, d1p9mc2

Details for d1p9ma3

PDB Entry: 1p9m (more details), 3.65 Å

PDB Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex

SCOP Domain Sequences for d1p9ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ma3 b.1.2.1 (A:197-299) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta
strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgit

SCOP Domain Coordinates for d1p9ma3:

Click to download the PDB-style file with coordinates for d1p9ma3.
(The format of our PDB-style files is described here.)

Timeline for d1p9ma3: